Labels

Sabtu, 29 September 2012

Keperawatan Transkultural

TEORI MODEL KEPERAWATAN
BERHUBUNGAN DENGAN KEPERAWATAN TRANSKULTURAL

TeoriLeininger
TeoriLeiningertentangkeragamanpelayananberdasarkankulturdanuniversalitas (1991) menyatakanbahwakasihsayangmerupakanintidarikeperawatan, dominan, karakteristik, dancirri khaskeperawatan. Ada beberapajenispelayananmanusiaberdasarkankulturdalampenerapan, proses, danbentuknya.
Faktorsosial, sepertikepercayaanklien, politik, kultur, dantradisimerupakanfaktorsignifikan yang memengaruhipelayanan, kesehatanklien, danbentukpenyakit.
TujuanTeoriLeiningeradalahmenyediakanbagiklienpelayanankesehatanspesifiksecarakultural. Untukmemberikanasuhankeperawatanbagikliendengankulturtertentu, perawataperlumemperhitungkantradisikulturklien, nilai-nilai, dankepercayaankedalamrencanakeperawatan.
Sebagaicontoh, beberapakulturpercayabahwakepaladalamsuatukomunitasharusadapadasaatmemutuskanjenispelayanankesehatansehinggatimpelayanankesehatanperlumembuatjadwalulangketikalingkunganmenginginkankepalakomunitas. Selainitu, terdapatperbedaancaraekspresi di antarakultur. Sebaagaicontoh, individuketurunan Iris tidakakanmengeluhkesakitan. Kontrasnya, individudarikulturTimur Tengah lebihmudahmengeluhsakit. Dari keduacontohtersebut, perawatperlulebihmengertikulturkliendalampraktikmenilaitingkat rasa sakitklien(misalnya, apakah rasa sakitsemakinbertambahatautetapsama?).
Peranperawatanpada transcultural nursing teory iniadalahmenjebataniantarasistemperawatan yang dilakukanmasyarakatawamdengansistemperawatanprosfesionalmelaluiasuhankeperawatan.Eksistensiperanperawattersebutdigambarkanolehleininger.olehkarenaituperawatharusmampumembuatkeputusandanrencanatindakankeperawatan yang akandiberikankepadamasyarakat. Jika di sesuaikandengan proses keperawatan, haltersebutmerupakantahapperencanaantindakankeperawatan.
Tindakankeperawatan yang diberikankepadaklienharustetapmemperhatikantigaperinsipasuhankeperawatan, yaitu :
1.    culture care preservation/maintenance, yaituprinsipmembantu,memfasilitasi,ataumemperhatikanfenomenabudayagunamembantuindividumenentukantingkankesehatandangayahidup yang di inginkan.
2.    Culture care accommodation/negatiation,yaitu prisipmembantu,memfasilitasi, ataumemperhatikanfenomenabudaya,yangmerefleksikancara-carauntukberadaptasi,ataubernegosiasiataumempertimbangkankondisikesehatandangayahidupindividuatauklien.
3.    culture care repatterning/restructuring,yaitu :prinsipmerekonstruksiataumengubahdesainuntukmembantumemperbaikikondisikesehatandanpolahidupklienkearahlebihbaik.
Konsepdalam Transcultural Nursing
1)    Budayaadalahnormaatauaturantindakandarianggotakelompok yang
dipelajari, dandibagisertamemberipetunjukdalamberfikir, bertindakdan
mengambilkeputusan.
2)    Nilaibudayaadalahkeinginanindividuatautindakan yang lebihdiinginkan
atausesuatutindakan yang dipertahankanpadasuatuwaktutertentudan
melandasitindakandankeputusan.
3)    Perbedaanbudayadalamasuhankeperawatanmerupakanbentuk yang
optimal daeipemberianasuhankeperawatan, mengacupadakemungkinan
variasipendekatankeperawatan yang dibutuhkanuntukmemberikanasuhan
budaya yang menghargainilaibudayaindividu, kepercayaandantindakan
termasukkepekaanterhadaplingkungandariindividu yang datangdan
individu yang mungkinkembalilagi (Leininger, 1985).
4)    Etnosentrisadalahpersepsi yang dimilikiolehindividu yang menganggap
bahwabudayanyaadalah yang terbaikdiantarabudaya-budaya yang dimiliki
oleh orang lain.
5)    Etnisberkaitandenganmanusiadarirastertentuataukelompokbudaya yang
digolongkanmenurutciri-ciridankebiasaan yang lazim.
6)    Rasadalahperbedaanmacam-macammanusiadidasarkanpada
mendiskreditkanasalmuasalmanusia
7)    Etnografiadalahilmu yang mempelajaribudaya. Pendekatanmetodologi
padapenelitianetnografimemungkinkanperawatuntukmengembangkan
kesadaran yang tinggipadaperbedaanbudayasetiapindividu, menjelaskan
dasarobservasiuntukmempelajarilingkungandan orang-orang, dansaling
memberikantimbalbalikdiantarakeduanya.
8)    Care adalahfenomena yang berhubungandenganbimbingan, bantuan,
dukunganperilakupadaindividu, keluarga, kelompokdenganadanyakejadian
untukmemenuhikebutuhanbaikaktualmaupunpotensialuntukmeningkatkan
kondisidankualitaskehidupanmanusia.
9)    Caring adalahtindakanlangsung yang diarahkanuntukmembimbing,
mendukungdanmengarahkanindividu, keluargaataukelompokpadakeadaan
yang nyataatauantisipasikebutuhanuntukmeningkatkankondisikehidupan
manusia.
10)    Cultural Care berkenaandengankemampuankognitifuntukmengetahuinilai,
kepercayaandanpolaekspresi yang digunakanuntukmebimbing, mendukung
ataumemberikesempatanindividu, keluargaataukelompokuntuk
mempertahankankesehatan, sehat, berkembangdanbertahanhidup, hidup
dalamketerbatasandanmencapaikematiandengandamai.
11)    Culturtal imposition berkenaandengankecenderungantenagakesehatan
untukmemaksakankepercayaan, praktikdannilaidiatasbudaya orang lain
karenapercayabahwa ide yang dimilikiolehperawatlebihtinggidaripada
kelompok lain.






FAKTA DI LAPANGAN
1.    Padasaathamil
•    Suamidariibuhamiltidakbolehmembunuhhewan (katak, kucing, ular, anjing).
•    Orang hamiltidakbolehmakanmakananhasillaut, karenadapatmenyebabkanbauamispada air ketuban.
•    Keinginanibuhamilharus di turutiolehsuaminya.
•    Dianjurkanpadaibuhamiluntukmengerjakantugasrumah (sepertimengepel, nyapu, dll) padasaatumurkehamilannyamenginjak 6 bulankeatas.
2.    Padasaatmelahirkan
•    Tradisiwanitaseringmeneriakkanpadawaktubersalindanmenghindarimenariknafasmelaluimulutkarenaakanmenyebabkan uterus naik.
•    Ketakutanakankecanduanobatdankepercayaanbahwa rasa sakitmerupakanakibatperbuatandosamasalalumembuatsehinggamenahan rasa sakittanpabanyakmengeluhataumemintaobatpenghilang rasa nyeri.
3.    Bayibarulahir
•    Adanyabayi yang barulahirtidak di mandikantetapi di bersihkandaridarahdan air ketubanibu.
•    Setelahmemandikanbayiparaibumemberikanbedakatau talk padatubuhbayi.
4.    Padamasa postpartum
•    Ibumenolakuntukmanditetapilebihmemilihmenyekadirinyadengan alas an untukmenjagakestabilandirisertakerentanankondisidingin.
•    Adanyapantanganmakananbagiibusepertimakandaging, telur, kacang-kacangan .Merekamempunyaianggapanbahwamakanantersebutakanmemperlama proses penyembuhan (akanmenyebabkangatal-gatal,akanmunculnanah)
•    Budayamakanmakanansepertisup,beras, danberasmerah.
•    Setelahmelahirkanbiasanyamenggunakanpengikatperutuntukpencegahanudaramasukkedalam uterus danuntukmempercepatpenyembuhan.


MITOS
1.    Padasaathamil
•    Merekamempercayaikalaumenyiksaataumembunuhbinatangdapatmempengaruhianak yang akandilahirkan, seperticacatfisikatau mental dandanbisamenyerupaibinatang yang dibunuhataudisiksatersebut.
•    Merekamempercayaipadasaatmelahirkanbau air ketubanberbau
amisdan air ketubanmudahpecah.
•    Bilamanakeinginandariseorangibuhamiltidakditurutimakaanak yang akandilahirkanakanmengeluarkan air liurterusmenerus.
•    Merekamempercayaibahwapadausiakandungan yang tua, ibuhamildenganberaktivitastinggiakanmemperlancardanmempermudahkelahiran.
2.    Padasaatmelahirkan
•    Beranggapandenganmenariknafasdalam-dalam, ibuhamilakanmemperolehtenaga yang kuatuntukmengeluarjkansibayinya.
•    Denganbanyakdosamenyebabkansulitnyapersalinandananak yang dilahirkanakanberperilakunakalseperti yang telahdilakukan orang tuanya.
3.    Bayibarulahir
•    Bayi tidak dimandikan karena pada jalannya nutrisi/pusarnya tidak bisa kering.
•    Bayi yangsetelah mandi menggunakan talk supaya bayi tidak mengalami kedinginan,alergi dan harum
4.    Pada masa postpartum
•    Ibu setelah melahirkan tidak mandi sebab menjaga keseimbangan dari tubuh dengan menghindari suasana dingin.
•    Pantangan makan seperti telur, daging, dan kacang-kacangan dapat memperlambat penyembuhan luka jalan lahir.
•    Di sarankan mengkomsumsi sup, beras, atau beras merah untuk mempercepat penyembuhan
•    Digunakan pengikat perut untuk memperlangsing tubuhnya kembali walaupun tak seperti semula.


TEORI
1.    Pada masa hamil suami/istri tidak harus menuruti ataupun menyiksa binatang . Adanya kecacatan disebabkan oleh keadaan kurangnya nutrisi pada saat kehamilan. Kegiatan yang berlebihan akan mempermudah keguguran.
2.    Pada masa melahirkan dengan bernafas dengan mulut dapat menyebabkan banyak bakteri mudah masuk sehingga rentan terkena penyakit yang berasal dari lingkungan. Uterus akan naik bila adanya pemijatan.
3.    Bayi yang baru lahir akan mudah terinfeksi oleh mikroorganisme, sehingga bayi yang lahir wajib di mandikan supaya terhindar dari infeksi. Penggunaan talk dapat menyebabkan alergi bagi bayi sebaiknya tidak usah digunakan.
4.    Pada ibu yang baru melahirkan rentan terkena infeksi dari mikroorganisme bilamana tidak di bersihkan atau mandi. Panatangan makan makanan yang mengandung protein dapat memperlambat penyembuhan luka. Menggunakan pengikat perut dapat menyebabkan sirkulasi darah tidak lancar,mengganggu sistem pencernaan, dan kesulitan bernafas.

OPINI
a.    Pada masa hamil
Adanya hubungan mengenai tidak diperbolehkannya menyiksa binatang ,makan ikan ataupun keinginan dari istri tidak dituruti akan berakibat pada bayi yang akan lahir merupakan hal yang sulit dinalar tetapi tidak menutup kemungkinan sebab masyarakat mempercayai dari peristiwa yang terjadi tetapi dalam hal ilmu kesehatan merupakan kekurangan dari nutrisi/gizi.
b.    Pada masa melahirkan
Hubungan antara bernafas dan nyeri untuk melahirkan bayi merupakan sebuah sugesti yang dapat berakibat menjadi sebuah fkiran ketika melahirkan, padahal bila menggunakan prosedur dan peralatan yang lengkap serta di tangani tenaga medis yang profesional akan menurunkan hal tersebut.
c.    Bayi baru lahir
Bayi yang baru lahir yang berlumuran darah supaya di bersihkan karena dalam darah tidak di ketahui ada mikroorganisme patogen yang dapat menginfeksi bayi. Penggunaan talk juga serti itu karena bayi mempunyai kulit yang lebih sensitif di takutkan dengan penggunan talk dapat menyebabkan alergi.
d.    Pada masa postpartum
Ibu yang baru melahirkan pastinya mengeluarkan cairan tidak sedikit sehingga lebih baiknya bila ibu tersebut dimandikan, agar terhindar dari mikroorganisme. Mengonsomsi makanan seperti telur , daging dan kacanng-kacangan baik untuk mempercepat penyembuhan sebab di dalam makanan tersebut terdapat protein yang besar untuk penyembuhan luka. Biasanya alat untuk memperlangsingkan perut ataupun alat untuk memperkecil ukuran perut sesudah melahirkan yang atau pengikat perut dapat di pakai tetapi jangan terlalu kuat mengikatnya karena dapat membahayakan ibu yang baru melahirkan. Dampat yang terjadi oleh penggunaan pengikat tersebut berupa sirkulasi darah yang kurang lancar, sistem pencernaan yang tidak dapat bekerja sempurna berdampak juga pada uterus .






DAFTAR PUSTAKA
Potter , Perry.2009.Fundamental Keperawatan:Jakarta.SalembaMedika
Anderson,elizabeth T.2006.Keperawatan Komunitas:Jakarta.EGC
Cultural Diversity in Nursing, (1997), Transcultural Nursing ; Basic Concepts and
Case Studies, Ditelusuritanggal29 September 2012dari
http://www.google.com/rnc.org/transculturalnursing

0 komentar

Poskan Komentar